PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00046.134
Common NameAMTR_s00046p00208680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25615.1 Da    PI: 10.0621
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00046.134genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.66.7e-281059251
                                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                              ri+n++ rqvtfskRrng+lKKA+EL +LCda+v ++ifsstgklye+ss
  evm_27.model.AmTr_v1.0_scaffold00046.134 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDADVGLVIFSSTGKLYEFSS 59
                                              8***********************************************96 PP

2K-box87.62.5e-2977171599
                                     K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73 
                                               ++ s ++++   +q+e+a L++++++Lq ++R+l+Ge+L+ L + eLq+Le+qLe sl+ +R kK+++l
  evm_27.model.AmTr_v1.0_scaffold00046.134  77 HQDSSSSSEVTLWQREAATLRQQLKSLQDNHRQLMGEELSGLGVGELQNLENQLEMSLRGVRRKKDQIL 145
                                               344478889999********************************************************* PP

                                     K-box  74 leqieelqkkekelqeenkaLrkkle 99 
                                               +eqi+elq+k + +++en++L +k+ 
  evm_27.model.AmTr_v1.0_scaffold00046.134 146 TEQIQELQRKGDLIHQENMELYRKVY 171
                                               **********************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.665161IPR002100Transcription factor, MADS-box
CDDcd002651.46E-44278No hitNo description
SuperFamilySSF554551.7E-33291IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003199.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.0E-2782170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.39286176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD ADVGLVIFSS TGKLYEFSSS  60
SMKSIIERYN KCKDERHQDS SSSSEVTLWQ REAATLRQQL KSLQDNHRQL MGEELSGLGV  120
GELQNLENQL EMSLRGVRRK KDQILTEQIQ ELQRKGDLIH QENMELYRKV YEARISNEGT  180
KTKSFSLTNF NFGDDPHMPI HLQLSQPQPQ QYESPARSMK LR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J1e-18286184Myocyte-specific enhancer factor 2A
3p57_I1e-18286184Myocyte-specific enhancer factor 2A
3p57_D1e-18286184Myocyte-specific enhancer factor 2A
3p57_C1e-18286184Myocyte-specific enhancer factor 2A
3p57_B1e-18286184Myocyte-specific enhancer factor 2A
3p57_A1e-18286184Myocyte-specific enhancer factor 2A
3kov_J1e-18286184Myocyte-specific enhancer factor 2A
3kov_I1e-18286184Myocyte-specific enhancer factor 2A
3kov_B1e-18286184Myocyte-specific enhancer factor 2A
3kov_A1e-18286184Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754432e-34HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankHG9755162e-34HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011627876.11e-116PREDICTED: agamous-like MADS-box protein AGL21
SwissprotQ9SZJ63e-93AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLU5DCD91e-164U5DCD9_AMBTC; Uncharacterized protein
STRINGVIT_18s0001g07900.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.12e-84AGAMOUS-like 21
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]